PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09456g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31467.4 Da    PI: 6.7503
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09456g00019.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-19119173256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ ++tkeq  +Le+ F+++++++ +++  LAk+lgLt rqV vWFqNrRa+ k
  Niben101Scf09456g00019.1 119 RKKLRLTKEQSAVLEDNFKEHSTLNPKQKLALAKRLGLTARQVEVWFQNRRARTK 173
                               678899***********************************************98 PP

2HD-ZIP_I/II123.11.4e-39119208191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rl+keq+++LE++F+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+
  Niben101Scf09456g00019.1 119 RKKLRLTKEQSAVLEDNFKEHSTLNPKQKLALAKRLGLTARQVEVWFQNRRARTKLKQTEVDCEFLKRCVENLTEENSRLQKEVQ 203
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Niben101Scf09456g00019.1 204 ELR-AL 208
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.8E-26293IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466898.98E-19108176IPR009057Homeodomain-like
PROSITE profilePS5007117.281115175IPR001356Homeobox domain
SMARTSM003891.0E-16117179IPR001356Homeobox domain
PfamPF000461.2E-16119173IPR001356Homeobox domain
CDDcd000861.51E-15119176No hitNo description
Gene3DG3DSA:1.10.10.607.2E-18119171IPR009057Homeodomain-like
PRINTSPR000311.0E-5146155IPR000047Helix-turn-helix motif
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5155171IPR000047Helix-turn-helix motif
Gene3DG3DSA:1.20.5.1702.7E-4172207No hitNo description
PfamPF021838.4E-10175209IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.1E-26175218IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0048467Biological Processgynoecium development
GO:0080127Biological Processfruit septum development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEDLGLSLSL SFPQNMTDSF PVHLNLDRKT SWTDSFPSSD RNSETCRVET KTFLKGIDVN  60
QLPATADAEE EAGVSSPNST ISSVSGNKRN DREPNCEEHE MERACSRGIS DEEDGETCRK  120
KLRLTKEQSA VLEDNFKEHS TLNPKQKLAL AKRLGLTARQ VEVWFQNRRA RTKLKQTEVD  180
CEFLKRCVEN LTEENSRLQK EVQELRALKL SPQFYMQMIP PTTLTMCPSC ERVASGPTST  240
PVNLRLGPPR QLNLWTTTPI SQGQFGQIDS YPTLARQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167175RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00050PBMTransfer from AT4G17460Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788263.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
RefseqXP_016489981.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466003e-99HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLK4C6R31e-141K4C6R3_SOLLC; Uncharacterized protein
STRINGSolyc06g060830.2.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-95homeobox protein 2